HNRNPC Antikörper

Produktnummer ABIN633234

Produktdetails anti-HNRNPC Antikörper

Target: HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPC Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HNRPC antibody was raised using a synthetic peptide corresponding to a region with amino acids LDINLAAEPKVNRGKAGVKRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPC Blocking Peptide, catalog no. 33R-4848, is also available for use as a blocking control in assays to test for specificity of this HNRPC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPC

Target: HNRNPC (Heterogeneous Nuclear Ribonucleoprotein C (C1/C2) (HNRNPC))

Andere Bezeichnung: HNRPC (HNRNPC Produkte)

Synonyme: C1 antikoerper, C2 antikoerper, HNRNP antikoerper, HNRPC antikoerper, SNRPC antikoerper, MGC53243 antikoerper, HNRNPC antikoerper, bZ1G18.4 antikoerper, fb57h12 antikoerper, fi16b11 antikoerper, wu:fb57h12 antikoerper, wu:fi16b11 antikoerper, zgc:55701 antikoerper, AL022939 antikoerper, D14Wsu171e antikoerper, Hnrpc antikoerper, Hnrpc1 antikoerper, Hnrpc2 antikoerper, hnRNPC1 antikoerper, hnRNPC2 antikoerper, hnrnp-C antikoerper, hnRNP C antikoerper, hnrnp antikoerper, hnrpc antikoerper, snrpc antikoerper, heterogeneous nuclear ribonucleoprotein C (C1/C2) antikoerper, heterogeneous nuclear ribonucleoprotein C (C1/C2) S homeolog antikoerper, heterogeneous nuclear ribonucleoprotein C antikoerper, heterogeneous nuclear ribonucleoprotein C (C1/C2) L homeolog antikoerper, HNRNPC antikoerper, hnrnpc.S antikoerper, hnrnpc antikoerper, Hnrnpc antikoerper, hnrnpc.L antikoerper

Hintergrund: HNRPC belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein can act as a tetramer and is involved in the assembly of 40S hnRNP particles.

Molekulargewicht: 33 kDa (MW of target protein)