SUPV3L1 Antikörper

Produktnummer ABIN633189

Produktdetails anti-SUPV3L1 Antikörper

Target: SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUPV3L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SUPV3 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QGPSADGDVGAELTRPLDKNEVKKVLDKFYKRKEIQKLGADYGLDARLFH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUPV3L1 Blocking Peptide, catalog no. 33R-7571, is also available for use as a blocking control in assays to test for specificity of this SUPV3L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUPV0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUPV3L1

Target: SUPV3L1 (Suppressor of Var1, 3-Like 1 (SUPV3L1))

Andere Bezeichnung: SUPV3L1 (SUPV3L1 Produkte)

Synonyme: SUV3 antikoerper, 6330443E10Rik antikoerper, wu:fc19b02 antikoerper, wu:fe37e06 antikoerper, Suv3 like RNA helicase antikoerper, suppressor of var1, 3-like 1 (S. cerevisiae) antikoerper, SUV3-like helicase antikoerper, SUPV3L1 antikoerper, Supv3l1 antikoerper, supv3l1 antikoerper

Hintergrund: SUPV3L1 is an ATPase and DNA/RNA helicase able to unwind DNA/DNA, DNA/RNA and RNA/RNA duplexes in the 5'-3' direction. SUPV3L1 may protect cells from apoptosis.

Molekulargewicht: 88 kDa (MW of target protein)