FGF2 Antikörper

Produktnummer ABIN633176

Produktdetails anti-FGF2 Antikörper

Target: FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FGF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FGF2 Blocking Peptide, catalog no. 33R-8018, is also available for use as a blocking control in assays to test for specificity of this FGF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FGF2

Target: FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))

Andere Bezeichnung: FGF2 (FGF2 Produkte)

Synonyme: BFGF antikoerper, FGF-2 antikoerper, FGFB antikoerper, HBGF-2 antikoerper, Fgf-2 antikoerper, Fgfb antikoerper, bFGF antikoerper, fibroblast growth factor 2 antikoerper, fibroblast growth factor 2 (basic) antikoerper, FGF2 antikoerper, Fgf2 antikoerper, fgf2 antikoerper

Hintergrund: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, C21-Steroid Hormone Metabolic Process, Inositol Metabolic Process, Glycosaminoglycan Metabolic Process, Protein targeting to Nucleus, S100 Proteine