MBL2 Antikörper (Middle Region)
-
- Target Alle MBL2 Antikörper anzeigen
- MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MBL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MBL2 antibody was raised against the middle region of MBL2
- Aufreinigung
- Affinity purified
- Immunogen
- MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN
- Top Product
- Discover our top product MBL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))
- Andere Bezeichnung
- MBL2 (MBL2 Produkte)
- Synonyme
- COLEC1 antikoerper, HSMBPC antikoerper, MBL antikoerper, MBL2D antikoerper, MBP antikoerper, MBP-C antikoerper, MBP1 antikoerper, MBPD antikoerper, pMBP-27 antikoerper, mbl2 antikoerper, MBL1 antikoerper, cMBl antikoerper, collectin antikoerper, Ab2-001 antikoerper, Ab2-011 antikoerper, L-MBP antikoerper, MBL-C antikoerper, COLEC2 antikoerper, mbl antikoerper, etID42583.2 antikoerper, fb68b07 antikoerper, hbl3 antikoerper, wu:fb68b07 antikoerper, zgc:109836 antikoerper, mannose binding lectin 2 antikoerper, Mannose-binding protein C antikoerper, mannose-binding lectin (protein C) 2, soluble antikoerper, mannose-binding lectin (protein C) 2 antikoerper, mannose-binding lectin family member 3, pseudogene antikoerper, MBL2 antikoerper, mbl2 antikoerper, Mbl2 antikoerper, MBL3P antikoerper
- Hintergrund
- This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.
- Molekulargewicht
- 24 kDa (MW of target protein)
- Pathways
- Komplementsystem, Positive Regulation of Immune Effector Process
-