MBL2 Antikörper (Middle Region)

Produktnummer ABIN633169

Produktdetails anti-MBL2 Antikörper

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MBL2 antibody was raised against the middle region of MBL2

Aufreinigung: Affinity purified

Immunogen: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBL2 Blocking Peptide, catalog no. 33R-4323, is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBL2

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Andere Bezeichnung: MBL2 (MBL2 Produkte)

Synonyme: COLEC1 antikoerper, HSMBPC antikoerper, MBL antikoerper, MBL2D antikoerper, MBP antikoerper, MBP-C antikoerper, MBP1 antikoerper, MBPD antikoerper, pMBP-27 antikoerper, mbl2 antikoerper, MBL1 antikoerper, cMBl antikoerper, collectin antikoerper, Ab2-001 antikoerper, Ab2-011 antikoerper, L-MBP antikoerper, MBL-C antikoerper, COLEC2 antikoerper, mbl antikoerper, etID42583.2 antikoerper, fb68b07 antikoerper, hbl3 antikoerper, wu:fb68b07 antikoerper, zgc:109836 antikoerper, mannose binding lectin 2 antikoerper, Mannose-binding protein C antikoerper, mannose-binding lectin (protein C) 2, soluble antikoerper, mannose-binding lectin (protein C) 2 antikoerper, mannose-binding lectin family member 3, pseudogene antikoerper, MBL2 antikoerper, mbl2 antikoerper, Mbl2 antikoerper, MBL3P antikoerper

Hintergrund: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Komplementsystem, Positive Regulation of Immune Effector Process