MBL2 Antikörper (Middle Region)

Produktnummer ABIN633169

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch MBL2 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für MBL2 Antikörper (Middle Region) (ABIN633169)

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MBL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MBL2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MBL2 antibody was raised against the middle region of MBL2

Aufreinigung: Affinity purified

Immunogen: MBL2 antibody was raised using the middle region of MBL2 corresponding to a region with amino acids KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MBL2 Blocking Peptide, (ABIN939709), is also available for use as a blocking control in assays to test for specificity of this MBL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MBL2

Target: MBL2 (Mannose-Binding Lectin (Protein C) 2, Soluble (MBL2))

Andere Bezeichnung: MBL2

Hintergrund: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognises mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Komplementsystem, Positive Regulation of Immune Effector Process