APBB3 Antikörper

Produktnummer ABIN633150

Produktdetails anti-APBB3 Antikörper

Target: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APBB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: APBB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYIQSMEPGAKCFAVRSLGWVEVPEEDLAPGKSSIAVNNCIQQLAQTRSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APBB3 Blocking Peptide, catalog no. 33R-8950, is also available for use as a blocking control in assays to test for specificity of this APBB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APBB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APBB3

Target: APBB3 (Amyloid beta (A4) Precursor Protein-Binding, Family B, Member 3 (APBB3))

Andere Bezeichnung: APBB3 (APBB3 Produkte)

Synonyme: Fe65l2 antikoerper, Rirl2 antikoerper, TR2S antikoerper, MGC142933 antikoerper, FE65L2 antikoerper, SRA antikoerper, amyloid beta (A4) precursor protein-binding, family B, member 3 antikoerper, steroid receptor RNA activator 1 antikoerper, amyloid beta precursor protein binding family B member 3 antikoerper, Apbb3 antikoerper, SRA1 antikoerper, APBB3 antikoerper, apbb3 antikoerper

Hintergrund: The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.

Molekulargewicht: 52 kDa (MW of target protein)