ATP6AP1 Antikörper (Middle Region)

Produktnummer ABIN633093

Produktdetails anti-ATP6AP1 Antikörper

Target: ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6AP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 AP1 antibody was raised against the middle region of ATP6 P1

Aufreinigung: Affinity purified

Immunogen: ATP6 AP1 antibody was raised using the middle region of ATP6 P1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6AP1 Blocking Peptide, catalog no. 33R-8700, is also available for use as a blocking control in assays to test for specificity of this ATP6AP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 P1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6AP1

Target: ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))

Andere Bezeichnung: ATP6AP1 (ATP6AP1 Produkte)

Synonyme: 16A antikoerper, ATP6IP1 antikoerper, ATP6S1 antikoerper, Ac45 antikoerper, CF2 antikoerper, VATPS1 antikoerper, XAP-3 antikoerper, XAP3 antikoerper, AC45 antikoerper, AI316502 antikoerper, AW108110 antikoerper, Atp6ip1 antikoerper, Atp6s1 antikoerper, C7-1 antikoerper, mFLJ00383 antikoerper, H+-ATPase antikoerper, ATPase H+ transporting accessory protein 1 antikoerper, ATPase, H+ transporting, lysosomal accessory protein 1 antikoerper, plasma membrane ATPase 4 antikoerper, ATP6AP1 antikoerper, Atp6ap1 antikoerper, LOC547525 antikoerper

Hintergrund: This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Proton Transport, SARS-CoV-2 Protein Interaktom