HLA-DQA2 Antikörper (Middle Region)

Produktnummer ABIN633062

Produktdetails anti-HLA-DQA2 Antikörper

Target: HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HLA-DQA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HLA-DQA2 antibody was raised against the middle region of HLA-DQA2

Aufreinigung: Affinity purified

Immunogen: HLA-DQA2 antibody was raised using the middle region of HLA-DQA2 corresponding to a region with amino acids LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HLA-DQA2 Blocking Peptide, catalog no. 33R-5275, is also available for use as a blocking control in assays to test for specificity of this HLA-DQA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DQA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HLA-DQA2

Target: HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))

Andere Bezeichnung: HLA-DQA2 (HLA-DQA2 Produkte)

Synonyme: DX-ALPHA antikoerper, HLA-DXA antikoerper, major histocompatibility complex, class II, DQ alpha 2 antikoerper, HLA-DQA2 antikoerper

Hintergrund: This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognised by CD4 T-cells.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg