MFN1 Antikörper (Middle Region)
-
- Target Alle MFN1 Antikörper anzeigen
- MFN1 (Mitofusin 1 (MFN1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MFN1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Mitofusin 1 antibody was raised against the middle region of MFN1
- Aufreinigung
- Affinity purified
- Immunogen
- Mitofusin 1 antibody was raised using the middle region of MFN1 corresponding to a region with amino acids QVDITQKQLEEEIARLPKEIDQLEKIQNNSKLLRNKAVQLENELENFTKQ
- Top Product
- Discover our top product MFN1 Primärantikörper
-
anti-Mitofusin 1 (MFN1) (AA 1-741) antibody
MFN1 Reaktivität: Human WB, ELISA, RNAi Wirt: Maus Monoclonal 3C9 unconjugated
anti-Mitofusin 1 (MFN1) (AA 1-234) antibodyMFN1 Reaktivität: Maus WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (AA 651-741) antibodyMFN1 Reaktivität: Maus, Ratte, Kaninchen, Huhn WB, ELISA, FACS, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (AA 622-741) antibodyMFN1 Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (AA 622-741) antibodyMFN1 Reaktivität: Human WB, IHC, ELISA, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (Internal Region) antibodyMFN1 Reaktivität: Human, Maus, Ratte WB, IHC, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (AA 622-741) antibodyMFN1 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (AA 209-469) antibodyMFN1 Reaktivität: Human WB, IHC, IHC (p) Wirt: Maus Monoclonal 4D11 unconjugated
anti-Mitofusin 1 (MFN1) (AA 745-756) antibodyMFN1 Reaktivität: Human, Kaninchen, Hund, Pferd, Affe IHC, IHC (p) Wirt: Ziege Polyclonal unconjugated
anti-Mitofusin 1 (MFN1) (AA 1-227) antibodyMFN1 Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Mitofusin 1 Blocking Peptide, catalog no. 33R-7768, is also available for use as a blocking control in assays to test for specificity of this Mitofusin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFN1 (Mitofusin 1 (MFN1))
- Andere Bezeichnung
- Mitofusin 1 (MFN1 Produkte)
- Synonyme
- mfn1 antikoerper, zgc:66150 antikoerper, mitofusin-1 antikoerper, MFN1 antikoerper, MFN2 antikoerper, hfzo1 antikoerper, hfzo2 antikoerper, 2310002F04Rik antikoerper, 6330416C07Rik antikoerper, D3Ertd265e antikoerper, HR2 antikoerper, mKIAA4032 antikoerper, Fzo1b antikoerper, mitofusin 1b antikoerper, mitofusin 1 antikoerper, mitofusin 1 S homeolog antikoerper, mfn1b antikoerper, MFN1 antikoerper, mfn1.S antikoerper, mfn1 antikoerper, Mfn1 antikoerper
- Hintergrund
- The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting.
- Molekulargewicht
- 84 kDa (MW of target protein)
-
