GAD Antikörper

Produktnummer ABIN633036

Produktdetails anti-GAD Antikörper

Target: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAD1 Blocking Peptide, catalog no. 33R-5764, is also available for use as a blocking control in assays to test for specificity of this GAD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAD

Target: GAD (GAD1) (Glutamate Decarboxylase 1 (Brain, 67kDa) (GAD1))

Andere Bezeichnung: GAD1 (GAD1 Produkte)

Synonyme: CPSQ1 antikoerper, GAD antikoerper, SCP antikoerper, GAD-67 antikoerper, cpsq1 antikoerper, gad1 antikoerper, gad1-A antikoerper, gad67 antikoerper, GAD67 antikoerper, GAD1 antikoerper, GLUTAMATE DECARBOXYLASE antikoerper, GLUTAMATE DECARBOXYLASE 1 antikoerper, MKP11.30 antikoerper, MKP11_30 antikoerper, glutamate decarboxylase antikoerper, EP10 antikoerper, GAD25 antikoerper, GAD44 antikoerper, Gad-1 antikoerper, Gad67 antikoerper, glutamate decarboxylase 1 antikoerper, glutamate decarboxylase 1 L homeolog antikoerper, glutamate decarboxylase antikoerper, glutamate decarboxylase 1b antikoerper, GAD1 antikoerper, gad1.1.L antikoerper, GAD antikoerper, Gad1 antikoerper, gad1b antikoerper

Hintergrund: This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67 kDa form and a less-frequent 25 kDa form.

Molekulargewicht: 67 kDa (MW of target protein)