ARC (Middle Region) Antikörper

Produktnummer ABIN632995

Produktdetails

Target: ARC

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ARC antibody was raised against the middle region of ARC

Aufreinigung: Affinity purified

Immunogen: ARC antibody was raised using the middle region of ARC corresponding to a region with amino acids ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ARC Blocking Peptide, catalog no. 33R-2534, is also available for use as a blocking control in assays to test for specificity of this ARC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: ARC

Synonyme: activity regulated cytoskeleton associated protein antikoerper, Arc antikoerper

Hintergrund: ARC is required for consolidation of synaptic plasticity as well as formation of long-term memory. It regulates endocytosis of AMPA receptors in response to synaptic activity. The protein is also required for homeostatic synaptic scaling of AMPA receptors.

Molekulargewicht: 45 kDa (MW of target protein)