ALKBH2 Antikörper
-
- Target Alle ALKBH2 Antikörper anzeigen
- ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALKBH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL
- Top Product
- Discover our top product ALKBH2 Primärantikörper
-
anti-AlkB, Alkylation Repair Homolog 2 (ALKBH2) (AA 1-261) antibody
ALKBH2 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 2 (ALKBH2) (AA 1-261) antibodyALKBH2 Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 2 (ALKBH2) (AA 108-157) antibodyALKBH2 Reaktivität: Human, Maus, Ratte, Kaninchen, Meerschweinchen, Affe, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 2 (ALKBH2) (Middle Region) antibodyALKBH2 Reaktivität: Human, Maus, Ratte, Kaninchen, Meerschweinchen, Rind (Kuh), Zebrafisch (Danio rerio), Hund, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 2 (ALKBH2) (C-Term) antibodyALKBH2 Reaktivität: Human, Maus, Ratte WB, EIA Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALKBH2 Blocking Peptide, catalog no. 33R-9735, is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))
- Andere Bezeichnung
- ALKBH2 (ALKBH2 Produkte)
- Synonyme
- si:dkey-65b12.2 antikoerper, ABH2 antikoerper, 9530023G02 antikoerper, AU016977 antikoerper, Abh2 antikoerper, mABH2 antikoerper, RGD1306377 antikoerper, alkB homolog 2, alpha-ketoglutarate dependent dioxygenase antikoerper, alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase antikoerper, ALKBH2 antikoerper, alkbh2 antikoerper, Alkbh2 antikoerper
- Hintergrund
- The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.
- Molekulargewicht
- 29 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-
