ALKBH2 Antikörper

Produktnummer ABIN632988

Der Kaninchen Polyklonal anti-ALKBH2 Antikörper (ABIN632988) detektiert spezifisch ALKBH2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für ALKBH2 Antikörper (ABIN632988)

Target: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALKBH2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ALKBH2 Antikörper

Aufreinigung: Affinity purified

Immunogen: ALKBH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPRKQATYGDAGLTYTFSGLTLSPKPWIPVLERIRDHVSGVTGQTFNFVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALKBH2 Blocking Peptide, (ABIN5612025), is also available for use as a blocking control in assays to test for specificity of this ALKBH2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALKBH2

Target: ALKBH2 (AlkB, Alkylation Repair Homolog 2 (ALKBH2))

Andere Bezeichnung: ALKBH2

Hintergrund: The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: DNA Reparatur