PSMC4 Antikörper
-
- Target Alle PSMC4 Antikörper anzeigen
- PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMC4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMC4 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEEIGILVEKAQDEIPALSVSRPQTGLSFLGPEPEDLEDLYSRYKKLQQE
- Top Product
- Discover our top product PSMC4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMC4 Blocking Peptide, catalog no. 33R-5902, is also available for use as a blocking control in assays to test for specificity of this PSMC4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMC4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMC4 (Proteasome (Prosome, Macropain) 26S Subunit, ATPase, 4 (PSMC4))
- Andere Bezeichnung
- PSMC4 (PSMC4 Produkte)
- Synonyme
- NCU02260.1 antikoerper, AO090003000692 antikoerper, DDBDRAFT_0188209 antikoerper, DDBDRAFT_0191435 antikoerper, DDB_0188209 antikoerper, DDB_0191435 antikoerper, MIP224 antikoerper, RPT3 antikoerper, S6 antikoerper, TBP-7 antikoerper, TBP7 antikoerper, CIP21 antikoerper, Tbp7 antikoerper, 26S protease regulatory subunit 6B antikoerper, regulatory particle, ATPase-like-3 antikoerper, 26S proteasome regulatory subunit 6B antikoerper, proteasome 26S subunit, ATPase 4 antikoerper, proteasome (prosome, macropain) 26S subunit, ATPase, 4 antikoerper, LOC732870 antikoerper, rpt-3 antikoerper, ATEG_04674 antikoerper, LELG_01296 antikoerper, HCAG_00039 antikoerper, LOC5568998 antikoerper, GL50803_7950 antikoerper, EDI_044950 antikoerper, AOR_1_1218154 antikoerper, PTRG_03339 antikoerper, psmC4 antikoerper, prs6b antikoerper, LOC100381342 antikoerper, psmc4 antikoerper, PSMC4 antikoerper, Psmc4 antikoerper
- Hintergrund
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Molekulargewicht
- 47 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway
-