PSPH Antikörper (Middle Region)
-
- Target Alle PSPH Antikörper anzeigen
- PSPH (Phosphoserine Phosphatase (PSPH))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSPH Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PSPH antibody was raised against the middle region of PSPH
- Aufreinigung
- Affinity purified
- Immunogen
- PSPH antibody was raised using the middle region of PSPH corresponding to a region with amino acids IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE
- Top Product
- Discover our top product PSPH Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSPH Blocking Peptide, catalog no. 33R-4067, is also available for use as a blocking control in assays to test for specificity of this PSPH antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSPH antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSPH (Phosphoserine Phosphatase (PSPH))
- Andere Bezeichnung
- PSPH (PSPH Produkte)
- Synonyme
- PSP antikoerper, PSPHD antikoerper, AI480570 antikoerper, PSPase antikoerper, PSPH antikoerper, psph antikoerper, MGC78828 antikoerper, zgc:112414 antikoerper, DDBDRAFT_0183847 antikoerper, DDBDRAFT_0230054 antikoerper, DDB_0183847 antikoerper, DDB_0230054 antikoerper, phosphoserine phosphatase antikoerper, phosphoserine phosphatase L homeolog antikoerper, PSP; O-phosphoserine phosphohydrolase; PSPase antikoerper, phosphoserine phosphatase SerB antikoerper, BPI fold containing family A member 2 antikoerper, PSPH antikoerper, Psph antikoerper, psph.L antikoerper, psph antikoerper, serB antikoerper, serB-1 antikoerper, LOC5568588 antikoerper, PSP antikoerper, Svir_29300 antikoerper, MMAH_RS03435 antikoerper, BPIFA2 antikoerper
- Hintergrund
- The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-