PSMD3 Antikörper

Produktnummer ABIN632900

Produktdetails anti-PSMD3 Antikörper

Target: PSMD3 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMD3 Blocking Peptide, catalog no. 33R-8042, is also available for use as a blocking control in assays to test for specificity of this PSMD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMD3

Target: PSMD3 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3))

Andere Bezeichnung: PSMD3 (PSMD3 Produkte)

Synonyme: P58 antikoerper, RPN3 antikoerper, S3 antikoerper, TSTA2 antikoerper, AI255837 antikoerper, AntP91a antikoerper, D11Bwg1349e antikoerper, Psd3 antikoerper, Tstap91a antikoerper, proteasome 26S subunit, non-ATPase 3 antikoerper, proteasome 26S subunit, non-ATPase 3 S homeolog antikoerper, proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 antikoerper, 26S proteasome non-ATPase regulatory subunit 3 antikoerper, PSMD3 antikoerper, psmd3.S antikoerper, Psmd3 antikoerper, rpn-3 antikoerper

Hintergrund: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway