BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) Antikörper

Produktnummer ABIN632802

Produktdetails

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C19 ORF62 antibody was raised against the N terminal Of C19 rf62

Aufreinigung: Affinity purified

Immunogen: C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF62 Blocking Peptide, catalog no. 33R-2140, is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Andere Bezeichnung: C19ORF62 (BABAM1 Produkte)

Synonyme: merit40 antikoerper, nba1 antikoerper, zgc:100909 antikoerper, c19orf62 antikoerper, C19orf62 antikoerper, MERIT40 antikoerper, NBA1 antikoerper, C7H19orf62 antikoerper, 5430437P03Rik antikoerper, Merit40 antikoerper, BRISC and BRCA1 A complex member 1 antikoerper, BRISC and BRCA1 A complex member 1 L homeolog antikoerper, babam1 antikoerper, BABAM1 antikoerper, babam1.L antikoerper, Babam1 antikoerper

Hintergrund: C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus