BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) Antikörper

Produktnummer ABIN632802

Der Kaninchen Polyklonal anti-BRISC and BRCA1 A Complex Member 1 Antikörper (ABIN632802) detektiert spezifisch BRISC and BRCA1 A Complex Member 1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für BRISC and BRCA1 A Complex Member 1 (BABAM1) (N-Term) Antikörper (ABIN632802)

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails

Bindungsspezifität: N-Term

Spezifität: C19 ORF62 antibody was raised against the N terminal Of C19 rf62

Aufreinigung: Affinity purified

Immunogen: C19 ORF62 antibody was raised using the N terminal Of C19 rf62 corresponding to a region with amino acids DRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C19ORF62 Blocking Peptide, (ABIN937526), is also available for use as a blocking control in assays to test for specificity of this C19ORF62 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF62 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: BRISC and BRCA1 A Complex Member 1 (BABAM1)

Andere Bezeichnung: C19ORF62

Hintergrund: C19orf62 is a component of the BRCA1-A complex, a complex that specifically recognises 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs).

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus