MLKL Antikörper (N-Term)
-
- Target Alle MLKL Antikörper anzeigen
- MLKL (Mixed Lineage Kinase Domain-Like (MLKL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MLKL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MLKL antibody was raised against the N terminal of MLKL
- Aufreinigung
- Affinity purified
- Immunogen
- MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE
- Top Product
- Discover our top product MLKL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MLKL Blocking Peptide, catalog no. 33R-2230, is also available for use as a blocking control in assays to test for specificity of this MLKL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLKL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MLKL (Mixed Lineage Kinase Domain-Like (MLKL))
- Andere Bezeichnung
- MLKL (MLKL Produkte)
- Synonyme
- MLKL antikoerper, 9130019I15Rik antikoerper, mixed lineage kinase domain like pseudokinase antikoerper, mixed lineage kinase domain-like antikoerper, MLKL antikoerper, mlkl antikoerper, Mlkl antikoerper
- Hintergrund
- The function of MLKL protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 54 kDa (MW of target protein)
-