MLKL Antikörper (N-Term)

Produktnummer ABIN632746

Produktdetails anti-MLKL Antikörper

Target: MLKL (Mixed Lineage Kinase Domain-Like (MLKL))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MLKL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MLKL antibody was raised against the N terminal of MLKL

Aufreinigung: Affinity purified

Immunogen: MLKL antibody was raised using the N terminal of MLKL corresponding to a region with amino acids DVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MLKL Blocking Peptide, catalog no. 33R-2230, is also available for use as a blocking control in assays to test for specificity of this MLKL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLKL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MLKL

Target: MLKL (Mixed Lineage Kinase Domain-Like (MLKL))

Andere Bezeichnung: MLKL (MLKL Produkte)

Synonyme: MLKL antikoerper, 9130019I15Rik antikoerper, mixed lineage kinase domain like pseudokinase antikoerper, mixed lineage kinase domain-like antikoerper, MLKL antikoerper, mlkl antikoerper, Mlkl antikoerper

Hintergrund: The function of MLKL protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 54 kDa (MW of target protein)