SLU7 Antikörper
-
- Target Alle SLU7 Antikörper anzeigen
- SLU7 (SLU7 Splicing Factor Homolog (SLU7))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLU7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH
- Top Product
- Discover our top product SLU7 Primärantikörper
-
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 138-310) antibody
SLU7 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (C-Term) antibodySLU7 Reaktivität: Human WB, IF, IHC (p), ICC Wirt: Kaninchen Polyclonal unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 1-586) antibodySLU7 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (Internal Region) antibodySLU7 Reaktivität: Human, Maus, Ratte WB, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 457-570) antibodySLU7 Reaktivität: Human, Maus, Ratte, Hund, Huhn WB, IF Wirt: Maus Monoclonal 35-hSlu7 unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (Internal Region) antibodySLU7 Reaktivität: Human, Maus, Ratte WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 60-86), (N-Term) antibodySLU7 Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB38451 unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 35-84) antibodySLU7 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Affe, Kaninchen, Meerschweinchen, Zebrafisch (Danio rerio), Fledermaus, Huhn, Schwein, Xenopus laevis WB Wirt: Kaninchen Polyclonal unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 1-586) antibodySLU7 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1D3-4A10 unconjugated
anti-SLU7 Splicing Factor Homolog (SLU7) (AA 202-251) antibodySLU7 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Affe, Kaninchen, Meerschweinchen, Fledermaus, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLU7 Blocking Peptide, catalog no. 33R-4475, is also available for use as a blocking control in assays to test for specificity of this SLU7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLU7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLU7 (SLU7 Splicing Factor Homolog (SLU7))
- Andere Bezeichnung
- SLU7 (SLU7 Produkte)
- Synonyme
- 9G8 antikoerper, hSlu7 antikoerper, AU018913 antikoerper, D11Ertd730e antikoerper, D3Bwg0878e antikoerper, 9g8 antikoerper, hslu7 antikoerper, wu:fc94e11 antikoerper, zgc:103640 antikoerper, CG1420 antikoerper, Dmel\\CG1420 antikoerper, SLU7 antikoerper, SLU7 homolog, splicing factor antikoerper, SLU7 splicing factor homolog (S. cerevisiae) antikoerper, SLU7 homolog, splicing factor L homeolog antikoerper, CG1420 gene product from transcript CG1420-RA antikoerper, SLU7 antikoerper, Slu7 antikoerper, slu7.L antikoerper, slu7 antikoerper
- Substanzklasse
- Influenza Protein
- Hintergrund
- Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process.
- Molekulargewicht
- 68 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interaktom
-
