GLUD2 Antikörper (N-Term)

Produktnummer ABIN632576

Produktdetails anti-GLUD2 Antikörper

Target: GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLUD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLUD2 antibody was raised against the N terminal of GLUD2

Aufreinigung: Affinity purified

Immunogen: GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLUD2 Blocking Peptide, catalog no. 33R-2428, is also available for use as a blocking control in assays to test for specificity of this GLUD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLUD2

Target: GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))

Andere Bezeichnung: GLUD2 (GLUD2 Produkte)

Synonyme: GDH2 antikoerper, GLUDP1 antikoerper, GLUTAMATE DEHYDROGENASE 2 antikoerper, T2I1.150 antikoerper, T2I1_150 antikoerper, glutamate dehydrogenase 2 antikoerper, glutamate dehydrogenase 2 antikoerper, glutamate dehydrogenase antikoerper, GLUD2 antikoerper, GDH2 antikoerper, NP_RS03950 antikoerper

Hintergrund: Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Synaptic Membrane