SDCCAG8 Antikörper (N-Term)
-
- Target Alle SDCCAG8 Antikörper anzeigen
- SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SDCCAG8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SDCCAG8 antibody was raised against the N terminal of SDCCAG8
- Aufreinigung
- Affinity purified
- Immunogen
- SDCCAG8 antibody was raised using the N terminal of SDCCAG8 corresponding to a region with amino acids HEETNMPTMHDLVHTINDQSQYIHHLEAEVKFCKEELSGMKNKIQVVVLE
- Top Product
- Discover our top product SDCCAG8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SDCCAG8 Blocking Peptide, catalog no. 33R-3716, is also available for use as a blocking control in assays to test for specificity of this SDCCAG8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDCCAG8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SDCCAG8 (serologically Defined Colon Cancer Antigen 8 (SDCCAG8))
- Andere Bezeichnung
- SDCCAG8 (SDCCAG8 Produkte)
- Synonyme
- si:dkey-60b15.1 antikoerper, BBS16 antikoerper, CCCAP antikoerper, CCCAP SLSN7 antikoerper, NPHP10 antikoerper, NY-CO-8 antikoerper, SLSN7 antikoerper, hCCCAP antikoerper, 2700048G21Rik antikoerper, 5730470G24Rik antikoerper, Cccap antikoerper, serologically defined colon cancer antigen 8 antikoerper, sdccag8 antikoerper, SDCCAG8 antikoerper, Sdccag8 antikoerper
- Hintergrund
- SDCCAG8 encodes a centrosome associated protein. This protein may be involved in organizing the centrosome during interphase and mitosis. Mutations in this gene are associated with retinal-renal ciliopathy.
- Molekulargewicht
- 83 kDa (MW of target protein)
- Pathways
- M Phase, Tube Formation
-