MTMR14 Antikörper (Middle Region)

Produktnummer ABIN632568

Produktdetails anti-MTMR14 Antikörper

Target: MTMR14 (Myotubularin Related Protein 14 (MTMR14))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTMR14 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MTMR14 antibody was raised against the middle region of MTMR14

Aufreinigung: Affinity purified

Immunogen: MTMR14 antibody was raised using the middle region of MTMR14 corresponding to a region with amino acids NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTMR14 Blocking Peptide, catalog no. 33R-6688, is also available for use as a blocking control in assays to test for specificity of this MTMR14 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR14 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTMR14

Target: MTMR14 (Myotubularin Related Protein 14 (MTMR14))

Andere Bezeichnung: MTMR14 (MTMR14 Produkte)

Synonyme: fc14d11 antikoerper, wu:fc14d11 antikoerper, MGC131146 antikoerper, C3orf29 antikoerper, 1110061O04Rik antikoerper, AW553738 antikoerper, C76151 antikoerper, RGD1304842 antikoerper, jumpy antikoerper, myotubularin related protein 14 antikoerper, myotubularin-related protein 14 antikoerper, myotubularin related protein 14 S homeolog antikoerper, mtmr14 antikoerper, LOC703936 antikoerper, mtmr14.S antikoerper, MTMR14 antikoerper, Mtmr14 antikoerper

Hintergrund: This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: Inositol Metabolic Process