MSRA Antikörper (Middle Region)
-
- Target Alle MSRA Antikörper anzeigen
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSRA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MSRA antibody was raised against the middle region of MSRA
- Aufreinigung
- Affinity purified
- Immunogen
- MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS
- Top Product
- Discover our top product MSRA Primärantikörper
-
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 27-235) antibody
MSRA Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 34-63), (N-Term) antibodyMSRA Reaktivität: Human, Maus WB, IF, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB18651 unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 1-100) antibodyMSRA Reaktivität: Human WB, IF, ELISA, IHC (p) Wirt: Maus Monoclonal 3C11 unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) antibodyMSRA Reaktivität: Human, Maus, Ratte IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 1-235) antibodyMSRA Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 1-235) antibodyMSRA Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 24-235) antibodyMSRA Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (C-Term) antibodyMSRA Reaktivität: Human, Maus, Ratte, Hund, Schwein, Kaninchen, Pferd, Meerschweinchen, Affe, Fledermaus, Huhn IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) antibodyMSRA Reaktivität: Human, Maus WB, IHC, IF/ICC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Methionine Sulfoxide Reductase A (MSRA) (AA 27-235) antibodyMSRA Reaktivität: Human WB, IHC, IP, ICC Wirt: Maus Monoclonal C4 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MSRA Blocking Peptide, catalog no. 33R-10213, is also available for use as a blocking control in assays to test for specificity of this MSRA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSRA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
- Andere Bezeichnung
- MSRA (MSRA Produkte)
- Synonyme
- 2310045J23Rik antikoerper, 6530413P12Rik antikoerper, MSR-A antikoerper, PMSR antikoerper, methionine sulfoxide reductase A antikoerper, Msra antikoerper, MSRA antikoerper
- Hintergrund
- This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 26 kDa (MW of target protein)
-
