MSRA Antikörper (Middle Region)
-
- Target Alle MSRA Antikörper anzeigen
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MSRA Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MSRA antibody was raised against the middle region of MSRA
- Aufreinigung
- Affinity purified
- Immunogen
- MSRA antibody was raised using the middle region of MSRA corresponding to a region with amino acids YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS
- Top Product
- Discover our top product MSRA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MSRA Blocking Peptide, catalog no. 33R-10213, is also available for use as a blocking control in assays to test for specificity of this MSRA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSRA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSRA (Methionine Sulfoxide Reductase A (MSRA))
- Andere Bezeichnung
- MSRA (MSRA Produkte)
- Synonyme
- 2310045J23Rik antikoerper, 6530413P12Rik antikoerper, MSR-A antikoerper, PMSR antikoerper, methionine sulfoxide reductase A antikoerper, Msra antikoerper, MSRA antikoerper
- Hintergrund
- This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene.
- Molekulargewicht
- 26 kDa (MW of target protein)
-