UBE2O Antikörper (Middle Region)

Produktnummer ABIN632557

Produktdetails anti-UBE2O Antikörper

Target: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBE2O Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBE2 O antibody was raised against the middle region of UBE2

Aufreinigung: Affinity purified

Immunogen: UBE2 O antibody was raised using the middle region of UBE2 corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBE2O Blocking Peptide, catalog no. 33R-10192, is also available for use as a blocking control in assays to test for specificity of this UBE2O antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBE2O

Target: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Andere Bezeichnung: UBE2O (UBE2O Produkte)

Synonyme: e2-230k antikoerper, E2-230K antikoerper, 9630022H21 antikoerper, B230113M03Rik antikoerper, mKIAA1734 antikoerper, RGD1310297 antikoerper, ubiquitin conjugating enzyme E2 O antikoerper, ubiquitin-conjugating enzyme E2O antikoerper, UBE2O antikoerper, ube2o antikoerper, Ube2o antikoerper

Hintergrund: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Molekulargewicht: 141 kDa (MW of target protein)