WFDC1 Antikörper (Middle Region)

Produktnummer ABIN632551

Produktdetails anti-WFDC1 Antikörper

Target: WFDC1 (WAP Four-Disulfide Core Domain 1 (WFDC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WFDC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WFDC1 antibody was raised against the middle region of WFDC1

Aufreinigung: Affinity purified

Immunogen: WFDC1 antibody was raised using the middle region of WFDC1 corresponding to a region with amino acids VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WFDC1 Blocking Peptide, catalog no. 33R-9410, is also available for use as a blocking control in assays to test for specificity of this WFDC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WFDC1

Target: WFDC1 (WAP Four-Disulfide Core Domain 1 (WFDC1))

Andere Bezeichnung: WFDC1 (WFDC1 Produkte)

Synonyme: WFDC1 antikoerper, zgc:158671 antikoerper, PS20 antikoerper, 2310058A03Rik antikoerper, ps20 antikoerper, WAP four-disulfide core domain 1 antikoerper, WFDC1 antikoerper, wfdc1 antikoerper, Wfdc1 antikoerper

Hintergrund: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.

Molekulargewicht: 21 kDa (MW of target protein)