ODF2 Antikörper (N-Term)
-
- Target Alle ODF2 Antikörper anzeigen
- ODF2 (Outer Dense Fiber of Sperm Tails 2 (ODF2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ODF2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ODF2 antibody was raised against the N terminal of ODF2
- Aufreinigung
- Affinity purified
- Immunogen
- ODF2 antibody was raised using the N terminal of ODF2 corresponding to a region with amino acids MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKG
- Top Product
- Discover our top product ODF2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ODF2 Blocking Peptide, catalog no. 33R-6401, is also available for use as a blocking control in assays to test for specificity of this ODF2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ODF2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ODF2 (Outer Dense Fiber of Sperm Tails 2 (ODF2))
- Andere Bezeichnung
- ODF2 (ODF2 Produkte)
- Synonyme
- odf84 antikoerper, odf2/1 antikoerper, odf2/2 antikoerper, DKFZp469J0214 antikoerper, CT134 antikoerper, ODF2/1 antikoerper, ODF2/2 antikoerper, ODF84 antikoerper, si:dkey-228b2.4 antikoerper, AI848335 antikoerper, MMTEST29 antikoerper, outer dense fiber of sperm tails 2 antikoerper, outer dense fiber of sperm tails 2a antikoerper, outer dense fiber of sperm tails 2 L homeolog antikoerper, ODF2 antikoerper, odf2 antikoerper, odf2a antikoerper, odf2.L antikoerper, Odf2 antikoerper
- Hintergrund
- The outer dense fibers are cytoskeletal structures that surround the axoneme in the middle piece and principal piece of the sperm tail. The fibers function in maintaining the elastic structure and recoil of the sperm tail as well as in protecting the tail from shear forces during epididymal transport and ejaculation. Defects in the outer dense fibers lead to abnormal sperm morphology and infertility. ODF2 is one of the major outer dense fiber proteins.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- M Phase
-