ACP1 Antikörper (Middle Region)
-
- Target Alle ACP1 Antikörper anzeigen
- ACP1 (Acid Phosphatase 1, Soluble (ACP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACP1 antibody was raised against the middle region of ACP1
- Aufreinigung
- Affinity purified
- Immunogen
- ACP1 antibody was raised using the middle region of ACP1 corresponding to a region with amino acids NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA
- Top Product
- Discover our top product ACP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACP1 Blocking Peptide, catalog no. 33R-6731, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACP1 (Acid Phosphatase 1, Soluble (ACP1))
- Andere Bezeichnung
- ACP1 (ACP1 Produkte)
- Synonyme
- HAAP antikoerper, 4632432E04Rik antikoerper, AI427468 antikoerper, Acp-1 antikoerper, LMW-PTP antikoerper, haap antikoerper, lmw-ptp antikoerper, ptp1a antikoerper, xlptp1 antikoerper, im:6910498 antikoerper, zgc:110844 antikoerper, Acp1 antikoerper, ACYPI006806 antikoerper, ACP antikoerper, ACPH antikoerper, APH antikoerper, Acph antikoerper, CG7899 antikoerper, Dmel\\CG7899 antikoerper, DDBDRAFT_0189318 antikoerper, DDBDRAFT_0266663 antikoerper, DDB_0189318 antikoerper, DDB_0266663 antikoerper, ACP1 antikoerper, XLPTP1 antikoerper, acp1 antikoerper, acp1a antikoerper, ptp1a-A antikoerper, LMW-PTPase antikoerper, acid phosphatase 1 antikoerper, acid phosphatase 1, soluble antikoerper, Acid phosphatase 1 antikoerper, acid phosphatase 1 L homeolog antikoerper, ACP1 antikoerper, Acp1 antikoerper, acp1 antikoerper, Acph-1 antikoerper, acp1.L antikoerper
- Hintergrund
- ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.
- Molekulargewicht
- 18 kDa (MW of target protein)
-