ACLY Antikörper (Middle Region)

Produktnummer ABIN632477

Produktdetails anti-ACLY Antikörper

Target: ACLY (ATP Citrate Lyase (ACLY))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACLY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACLY antibody was raised against the middle region of ACLY

Aufreinigung: Affinity purified

Immunogen: ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACLY Blocking Peptide, catalog no. 33R-5389, is also available for use as a blocking control in assays to test for specificity of this ACLY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACLY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACLY

Target: ACLY (ATP Citrate Lyase (ACLY))

Andere Bezeichnung: ACLY (ACLY Produkte)

Synonyme: ACLY antikoerper, DDBDRAFT_0205389 antikoerper, DDBDRAFT_0235360 antikoerper, DDB_0205389 antikoerper, DDB_0235360 antikoerper, ACL antikoerper, BcDNA:LD21334 antikoerper, CG8322 antikoerper, DmATPCL antikoerper, Dmel\\CG8322 antikoerper, anon-WO0140519.179 antikoerper, dATPCL antikoerper, l(2)01466 antikoerper, l(2)k09217 antikoerper, n(2)k09217 antikoerper, ATPCL antikoerper, CLATP antikoerper, A730098H14Rik antikoerper, AW538652 antikoerper, Clatp antikoerper, acly antikoerper, cb722 antikoerper, zgc:92008 antikoerper, ATP citrate lyase antikoerper, ATP citrate lyase S homeolog antikoerper, ATP-citrate synthase antikoerper, citrate synthase, mitochondrial antikoerper, atp-citrate synthase antikoerper, ATP citrate lyase a antikoerper, ACLY antikoerper, acly.S antikoerper, LOC587157 antikoerper, acly antikoerper, ATPCL antikoerper, LOC5564509 antikoerper, CpipJ_CPIJ010291 antikoerper, Bm1_26245 antikoerper, ACL antikoerper, Acly antikoerper, aclya antikoerper

Hintergrund: ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.

Molekulargewicht: 121 kDa (MW of target protein)

Pathways: Warburg Effekt