ACLY Antikörper (Middle Region)

Produktnummer ABIN632477

Der Kaninchen Polyklonal anti-ACLY Antikörper wird verwendet zum Nachweis von ACLY in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für ACLY Antikörper (Middle Region) (ABIN632477)

Target: ACLY (ATP Citrate Lyase (ACLY))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACLY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ACLY Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACLY antibody was raised against the middle region of ACLY

Aufreinigung: Affinity purified

Immunogen: ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACLY Blocking Peptide, (ABIN5611900), is also available for use as a blocking control in assays to test for specificity of this ACLY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACLY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACLY

Target: ACLY (ATP Citrate Lyase (ACLY))

Andere Bezeichnung: ACLY

Hintergrund: ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.

Molekulargewicht: 121 kDa (MW of target protein)

Pathways: Warburg Effekt