CDCA7L Antikörper (Middle Region)

Produktnummer ABIN632453

Produktdetails anti-CDCA7L Antikörper

Target: CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDCA7L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDCA7 L antibody was raised against the middle region of CDCA7

Aufreinigung: Affinity purified

Immunogen: CDCA7 L antibody was raised using the middle region of CDCA7 corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDCA7L Blocking Peptide, catalog no. 33R-7245, is also available for use as a blocking control in assays to test for specificity of this CDCA7L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDCA7L

Target: CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))

Andere Bezeichnung: CDCA7L (CDCA7L Produkte)

Synonyme: ram2 antikoerper, MGC154777 antikoerper, BC006933 antikoerper, JPO2 antikoerper, R1 antikoerper, RAM2 antikoerper, RAPGEF5 antikoerper, cell division cycle associated 7 like antikoerper, cell division cycle associated 7 like L homeolog antikoerper, cell division cycle-associated 7-like protein antikoerper, CDCA7L antikoerper, cdca7l.L antikoerper, LOC100454683 antikoerper, Cdca7l antikoerper

Hintergrund: CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.

Molekulargewicht: 46 kDa (MW of target protein)