CDCA7L Antikörper (Middle Region)
-
- Target Alle CDCA7L Antikörper anzeigen
- CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDCA7L Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDCA7 L antibody was raised against the middle region of CDCA7
- Aufreinigung
- Affinity purified
- Immunogen
- CDCA7 L antibody was raised using the middle region of CDCA7 corresponding to a region with amino acids PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED
- Top Product
- Discover our top product CDCA7L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDCA7L Blocking Peptide, catalog no. 33R-7245, is also available for use as a blocking control in assays to test for specificity of this CDCA7L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDCA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDCA7L (Cell Division Cycle Associated 7-Like (CDCA7L))
- Andere Bezeichnung
- CDCA7L (CDCA7L Produkte)
- Synonyme
- ram2 antikoerper, MGC154777 antikoerper, BC006933 antikoerper, JPO2 antikoerper, R1 antikoerper, RAM2 antikoerper, RAPGEF5 antikoerper, cell division cycle associated 7 like antikoerper, cell division cycle associated 7 like L homeolog antikoerper, cell division cycle-associated 7-like protein antikoerper, CDCA7L antikoerper, cdca7l.L antikoerper, LOC100454683 antikoerper, Cdca7l antikoerper
- Hintergrund
- CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.
- Molekulargewicht
- 46 kDa (MW of target protein)
-