DAPP1 Antikörper (Middle Region)

Produktnummer ABIN632442

Produktdetails anti-DAPP1 Antikörper

Target: DAPP1 (Dual Adaptor of Phosphotyrosine and 3-phosphoinositides (DAPP1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAPP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DAPP1 antibody was raised against the middle region of DAPP1

Aufreinigung: Affinity purified

Immunogen: DAPP1 antibody was raised using the middle region of DAPP1 corresponding to a region with amino acids SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAPP1 Blocking Peptide, catalog no. 33R-8628, is also available for use as a blocking control in assays to test for specificity of this DAPP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAPP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAPP1

Target: DAPP1 (Dual Adaptor of Phosphotyrosine and 3-phosphoinositides (DAPP1))

Andere Bezeichnung: DAPP1 (DAPP1 Produkte)

Synonyme: BAM32 antikoerper, DAPP1 antikoerper, zgc:111998 antikoerper, bam32 antikoerper, Bam32 antikoerper, dual adaptor of phosphotyrosine and 3-phosphoinositides 1 antikoerper, dual adaptor of phosphotyrosine and 3-phosphoinositides antikoerper, dual adaptor for phosphotyrosine and 3-phosphoinositides 1 antikoerper, DAPP1 antikoerper, Dapp1 antikoerper, dapp1 antikoerper

Hintergrund: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Molekulargewicht: 32 kDa (MW of target protein)

Pathways: BCR Signaling