Kallikrein 2 Antikörper (Middle Region)

Produktnummer ABIN632433

Produktdetails anti-Kallikrein 2 Antikörper

Target: Kallikrein 2 (KLK2)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kallikrein 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLK2 antibody was raised against the middle region of KLK2

Aufreinigung: Affinity purified

Immunogen: KLK2 antibody was raised using the middle region of KLK2 corresponding to a region with amino acids KHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASG

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK2 Blocking Peptide, catalog no. 33R-4419, is also available for use as a blocking control in assays to test for specificity of this KLK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kallikrein 2

Target: Kallikrein 2 (KLK2)

Andere Bezeichnung: KLK2 (KLK2 Produkte)

Synonyme: KLK2A2 antikoerper, hGK-1 antikoerper, hK2 antikoerper, KLK2 antikoerper, Ton antikoerper, rGK-2 antikoerper, Klk2 antikoerper, kallikrein related peptidase 2 antikoerper, kallikrein-related peptidase 2 antikoerper, kallikrein-2 antikoerper, kallikrein 1-related peptidase C2 antikoerper, KLK2 antikoerper, LOC748637 antikoerper, Klk1c2 antikoerper, LOC100716976 antikoerper

Hintergrund: Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Komplementsystem