HSPA6 Antikörper

Produktnummer ABIN632402

Produktdetails anti-HSPA6 Antikörper

Target: HSPA6 (Heat Shock 70kDa Protein 6 (HSP70B') (HSPA6))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HSPA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPA6 Blocking Peptide, catalog no. 33R-2819, is also available for use as a blocking control in assays to test for specificity of this HSPA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPA6

Target: HSPA6 (Heat Shock 70kDa Protein 6 (HSP70B') (HSPA6))

Andere Bezeichnung: HSPA6 (HSPA6 Produkte)

Synonyme: HSPA6 antikoerper, HSP70B' antikoerper, heat shock protein family A (Hsp70) member 6 antikoerper, HSPA6 antikoerper

Hintergrund: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognise nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.

Molekulargewicht: 71 kDa (MW of target protein)