PPIH Antikörper

Produktnummer ABIN632391

Produktdetails anti-PPIH Antikörper

Target: PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPIH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPIH antibody was raised using a synthetic peptide corresponding to a region with amino acids DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPIH Blocking Peptide, catalog no. 33R-1933, is also available for use as a blocking control in assays to test for specificity of this PPIH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPIH

Target: PPIH (Peptidylprolyl Isomerase H (Cyclophilin H) (PPIH))

Andere Bezeichnung: PPIH (PPIH Produkte)

Synonyme: CYP-20 antikoerper, CYPH antikoerper, SnuCyp-20 antikoerper, USA-CYP antikoerper, RGD1564921 antikoerper, cyp-20 antikoerper, cyph antikoerper, snucyp-20 antikoerper, usa-cyp antikoerper, PPIH antikoerper, zgc:136730 antikoerper, zgc:158595 antikoerper, zgc:55766 antikoerper, zgc:86780 antikoerper, 1100001J08Rik antikoerper, 2010111B15Rik antikoerper, 4833408F11Rik antikoerper, AI464484 antikoerper, D4Wsu43e antikoerper, peptidylprolyl isomerase H antikoerper, peptidylprolyl isomerase H (cyclophilin H) antikoerper, peptidylprolyl isomerase H L homeolog antikoerper, peptidyl prolyl isomerase H antikoerper, PPIH antikoerper, Ppih antikoerper, ppih antikoerper, ppih.L antikoerper

Hintergrund: The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.

Molekulargewicht: 19 kDa (MW of target protein)