AP2B1 Antikörper (Middle Region)
-
- Target Alle AP2B1 Antikörper anzeigen
- AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AP2B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AP2 B1 antibody was raised against the middle region of AP2 1
- Aufreinigung
- Affinity purified
- Immunogen
- AP2 B1 antibody was raised using the middle region of AP2 1 corresponding to a region with amino acids DMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSI
- Top Product
- Discover our top product AP2B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AP2B1 Blocking Peptide, catalog no. 33R-2077, is also available for use as a blocking control in assays to test for specificity of this AP2B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))
- Andere Bezeichnung
- AP2B1 (AP2B1 Produkte)
- Synonyme
- 5-HT(2B) antikoerper, 5-HT2B antikoerper, ADTB2 antikoerper, AP105B antikoerper, AP2-BETA antikoerper, CLAPB1 antikoerper, 1300012O03Rik antikoerper, AI788979 antikoerper, fa16e07 antikoerper, wu:fa16c06 antikoerper, wu:fa16e07 antikoerper, wu:fc18c08 antikoerper, zgc:55659 antikoerper, 5-hydroxytryptamine receptor 2B antikoerper, adaptor related protein complex 2 beta 1 subunit antikoerper, adaptor-related protein complex 2, beta 1 subunit antikoerper, adaptor related protein complex 2 beta 1 subunit L homeolog antikoerper, HTR2B antikoerper, AP2B1 antikoerper, Ap2b1 antikoerper, ap2b1 antikoerper, ap2b1.L antikoerper
- Hintergrund
- AP2B1 is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.
- Molekulargewicht
- 105 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signalübertragung, EGFR Downregulation
-