USP12 Antikörper (Middle Region)
-
- Target Alle USP12 Antikörper anzeigen
- USP12 (Ubiquitin Specific Peptidase 12 (USP12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser USP12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- USP12 antibody was raised against the middle region of USP12
- Aufreinigung
- Affinity purified
- Immunogen
- USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG
- Top Product
- Discover our top product USP12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
USP12 Blocking Peptide, catalog no. 33R-4187, is also available for use as a blocking control in assays to test for specificity of this USP12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP12 (Ubiquitin Specific Peptidase 12 (USP12))
- Andere Bezeichnung
- USP12 (USP12 Produkte)
- Synonyme
- UBH1 antikoerper, USP12L1 antikoerper, usp12 antikoerper, USP12P1 antikoerper, sb:eu882 antikoerper, wu:fi09d12 antikoerper, Ubh1 antikoerper, ubh1 antikoerper, usp12l1 antikoerper, ubiquitin specific peptidase 12 antikoerper, ubiquitin specific peptidase 12a antikoerper, ubiquitin specific peptidase 12 L homeolog antikoerper, ubiquitin specific peptidase 12 S homeolog antikoerper, USP12 antikoerper, usp12 antikoerper, Usp12 antikoerper, usp12a antikoerper, usp12.L antikoerper, usp12.S antikoerper
- Hintergrund
- USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.
- Molekulargewicht
- 43 kDa (MW of target protein)
-