USP12 Antikörper (Middle Region)

Produktnummer ABIN632371

Produktdetails anti-USP12 Antikörper

Target: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser USP12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: USP12 antibody was raised against the middle region of USP12

Aufreinigung: Affinity purified

Immunogen: USP12 antibody was raised using the middle region of USP12 corresponding to a region with amino acids ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

USP12 Blocking Peptide, catalog no. 33R-4187, is also available for use as a blocking control in assays to test for specificity of this USP12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu USP12

Target: USP12 (Ubiquitin Specific Peptidase 12 (USP12))

Andere Bezeichnung: USP12 (USP12 Produkte)

Synonyme: UBH1 antikoerper, USP12L1 antikoerper, usp12 antikoerper, USP12P1 antikoerper, sb:eu882 antikoerper, wu:fi09d12 antikoerper, Ubh1 antikoerper, ubh1 antikoerper, usp12l1 antikoerper, ubiquitin specific peptidase 12 antikoerper, ubiquitin specific peptidase 12a antikoerper, ubiquitin specific peptidase 12 L homeolog antikoerper, ubiquitin specific peptidase 12 S homeolog antikoerper, USP12 antikoerper, usp12 antikoerper, Usp12 antikoerper, usp12a antikoerper, usp12.L antikoerper, usp12.S antikoerper

Hintergrund: USP12 is a deubiquitinating enzyme. USP12 has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. USP12 is not involved in deubiquitination of monoubiquitinated FANCD2.

Molekulargewicht: 43 kDa (MW of target protein)