GLUD2 Antikörper (N-Term)
-
- Target Alle GLUD2 Antikörper anzeigen
- GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLUD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLUD2 antibody was raised against the N terminal of GLUD2
- Aufreinigung
- Affinity purified
- Immunogen
- GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR
- Top Product
- Discover our top product GLUD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLUD2 Blocking Peptide, catalog no. 33R-6630, is also available for use as a blocking control in assays to test for specificity of this GLUD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLUD2 (Glutamate Dehydrogenase 2 (GLUD2))
- Andere Bezeichnung
- GLUD2 (GLUD2 Produkte)
- Synonyme
- GDH2 antikoerper, GLUDP1 antikoerper, GLUTAMATE DEHYDROGENASE 2 antikoerper, T2I1.150 antikoerper, T2I1_150 antikoerper, glutamate dehydrogenase 2 antikoerper, glutamate dehydrogenase 2 antikoerper, glutamate dehydrogenase antikoerper, GLUD2 antikoerper, GDH2 antikoerper, NP_RS03950 antikoerper
- Hintergrund
- Glutamate dehydrogenase (EC 1.4.1.3) catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.
- Molekulargewicht
- 61 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-