PDHB Antikörper

Produktnummer ABIN632317

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PDHB in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für PDHB Antikörper (ABIN632317)

Target: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDHB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PDHB Antikörper

Aufreinigung: Affinity purified

Immunogen: PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDHB Blocking Peptide, (ABIN938817), is also available for use as a blocking control in assays to test for specificity of this PDHB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDHB

Target: PDHB (Pyruvate Dehydrogenase beta (PDHB))

Andere Bezeichnung: PDHB

Hintergrund: The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Warburg Effekt