PDHB Antikörper
-
- Target Alle PDHB Antikörper anzeigen
- PDHB (Pyruvate Dehydrogenase beta (PDHB))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDHB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID
- Top Product
- Discover our top product PDHB Primärantikörper
-
anti-Pyruvate Dehydrogenase beta (PDHB) (AA 250-359) antibody
PDHB Reaktivität: Human WB, ELISA, IHC (p) Wirt: Maus Monoclonal 2B2 unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) (AA 31-341) antibodyPDHB Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) antibodyPDHB Reaktivität: Human WB, IHC Wirt: Kaninchen Monoclonal unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) (AA 1-359) antibodyPDHB Reaktivität: Human WB, IF Wirt: Maus Polyclonal unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) (AA 1-300) antibodyPDHB Reaktivität: Human IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) (N-Term) antibodyPDHB Reaktivität: Human, Ratte, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) (AA 324-356), (C-Term) antibodyPDHB Reaktivität: Human, Ratte, Maus WB Wirt: Kaninchen Polyclonal RB49284 unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) antibodyPDHB Reaktivität: Human, Ratte, Maus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Pyruvate Dehydrogenase beta (PDHB) (AA 1-359) antibodyPDHB Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDHB Blocking Peptide, catalog no. 33R-3431, is also available for use as a blocking control in assays to test for specificity of this PDHB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDHB (Pyruvate Dehydrogenase beta (PDHB))
- Andere Bezeichnung
- PDHB (PDHB Produkte)
- Synonyme
- CG 11876 antikoerper, Dmel\\CG11876 antikoerper, E1beta antikoerper, PDHB antikoerper, zgc:64062 antikoerper, wu:fc76a05 antikoerper, PDHBD antikoerper, PDHE1-B antikoerper, PHE1B antikoerper, 2610103L06Rik antikoerper, AL024199 antikoerper, C81408 antikoerper, CG11876 gene product from transcript CG11876-RA antikoerper, pyruvate dehydrogenase E1 beta subunit antikoerper, pyruvate dehydrogenase (lipoamide) beta antikoerper, CG11876 antikoerper, pdhb antikoerper, PDHB antikoerper, Pdhb antikoerper
- Hintergrund
- The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Warburg Effekt
-
