GREM2 Antikörper
-
- Target Alle GREM2 Antikörper anzeigen
- GREM2 (Gremlin 2 (GREM2))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GREM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK
- Top Product
- Discover our top product GREM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GREM2 Blocking Peptide, catalog no. 33R-6009, is also available for use as a blocking control in assays to test for specificity of this GREM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GREM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GREM2 (Gremlin 2 (GREM2))
- Andere Bezeichnung
- GREM2 (GREM2 Produkte)
- Synonyme
- prdc antikoerper, zgc:112207 antikoerper, RGD1560008 antikoerper, Gremlin2 antikoerper, Prdc antikoerper, CKTSF1B2 antikoerper, DAND3 antikoerper, PRDC antikoerper, gremlin 2, DAN family BMP antagonist antikoerper, gremlin 2, DAN family BMP antagonist b antikoerper, gremlin 2, cysteine knot superfamily antikoerper, GREM2 antikoerper, grem2b antikoerper, grem2 antikoerper, Grem2 antikoerper
- Hintergrund
- This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.
- Molekulargewicht
- 17 kDa (MW of target protein)
-