GREM2 Antikörper

Produktnummer ABIN632313

Produktdetails anti-GREM2 Antikörper

Target: GREM2 (Gremlin 2 (GREM2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GREM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GREM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GREM2 Blocking Peptide, catalog no. 33R-6009, is also available for use as a blocking control in assays to test for specificity of this GREM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GREM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GREM2

Target: GREM2 (Gremlin 2 (GREM2))

Andere Bezeichnung: GREM2 (GREM2 Produkte)

Synonyme: prdc antikoerper, zgc:112207 antikoerper, RGD1560008 antikoerper, Gremlin2 antikoerper, Prdc antikoerper, CKTSF1B2 antikoerper, DAND3 antikoerper, PRDC antikoerper, gremlin 2, DAN family BMP antagonist antikoerper, gremlin 2, DAN family BMP antagonist b antikoerper, gremlin 2, cysteine knot superfamily antikoerper, GREM2 antikoerper, grem2b antikoerper, grem2 antikoerper, Grem2 antikoerper

Hintergrund: This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation.

Molekulargewicht: 17 kDa (MW of target protein)