ALKBH3 Antikörper
-
- Target Alle ALKBH3 Antikörper anzeigen
- ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALKBH3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ALKBH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS
- Top Product
- Discover our top product ALKBH3 Primärantikörper
-
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-170) antibody
ALKBH3 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-139) antibodyALKBH3 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2A5-4F5 unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 242-269), (C-Term) antibodyALKBH3 Reaktivität: Human, Maus WB, IHC (p) Wirt: Kaninchen Polyclonal RB22074 unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-286) antibodyALKBH3 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (Internal Region) antibodyALKBH3 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 216-265) antibodyALKBH3 Reaktivität: Human, Maus, Ratte, Kaninchen, Pferd, Fledermaus, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-286) antibodyALKBH3 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (AA 1-286) antibody (APC)ALKBH3 Reaktivität: Human IHC, IF, FACS, ICC Wirt: Kaninchen Polyclonal APC
anti-AlkB, Alkylation Repair Homolog 3 (ALKBH3) (Middle Region) antibodyALKBH3 Reaktivität: Human, Maus, Ratte, Kaninchen, Pferd, Schwein, Rind (Kuh), Hund, Meerschweinchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALKBH3 Blocking Peptide, catalog no. 33R-2593, is also available for use as a blocking control in assays to test for specificity of this ALKBH3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALKBH3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALKBH3 (AlkB, Alkylation Repair Homolog 3 (ALKBH3))
- Andere Bezeichnung
- ALKBH3 (ALKBH3 Produkte)
- Synonyme
- ABH3 antikoerper, DEPC-1 antikoerper, DEPC1 antikoerper, PCA1 antikoerper, 1700108H04Rik antikoerper, 1810020C19Rik antikoerper, Abh3 antikoerper, mABH3 antikoerper, alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase L homeolog antikoerper, alkB homolog 3, alpha-ketoglutaratedependent dioxygenase antikoerper, alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase antikoerper, alkbh3.L antikoerper, ALKBH3 antikoerper, Alkbh3 antikoerper
- Hintergrund
- The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methyladenine and 3-methylcytosine.
- Molekulargewicht
- 33 kDa (MW of target protein)
- Pathways
- DNA Reparatur
-
