GRAP Antikörper (Middle Region)

Produktnummer ABIN632276

Produktdetails anti-GRAP Antikörper

Target: GRAP (GRB2-Related Adaptor Protein (GRAP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRAP antibody was raised against the middle region of GRAP

Aufreinigung: Affinity purified

Immunogen: GRAP antibody was raised using the middle region of GRAP corresponding to a region with amino acids KRQIFLRDEEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRAP Blocking Peptide, catalog no. 33R-4634, is also available for use as a blocking control in assays to test for specificity of this GRAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRAP

Target: GRAP (GRB2-Related Adaptor Protein (GRAP))

Andere Bezeichnung: GRAP (GRAP Produkte)

Synonyme: 8430435N19Rik antikoerper, BB233594 antikoerper, GRAP antikoerper, grap antikoerper, zgc:110202 antikoerper, MGC109892 antikoerper, si:dkeyp-9d4.1 antikoerper, Grap antikoerper, GRB2-related adaptor protein antikoerper, GRB2-related adapter protein antikoerper, GRB2-related adaptor protein a antikoerper, GRB2-related adaptor protein b antikoerper, GRAP antikoerper, Grap antikoerper, LOC489534 antikoerper, grapa antikoerper, grapb antikoerper, LOC100727005 antikoerper

Hintergrund: This gene encodes a member of the GRB2/Sem5/Drk family. This member functions as a cytoplasmic signaling protein which contains an SH2 domain flanked by two SH3 domains. The SH2 domain interacts with ligand-activated receptors for stem cell factor and erythropoietin, and facilitates the formation of a stable complex with the BCR-ABL oncoprotein. This protein also associates with the Ras guanine nucleotide exchange factor SOS1 (son of sevenless homolog 1) through its N-terminal SH3 domain.

Molekulargewicht: 25 kDa (MW of target protein)