PRKAB1 Antikörper (N-Term)

Produktnummer ABIN632268

Produktdetails anti-PRKAB1 Antikörper

Target: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKAB1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKAB1 antibody was raised against the N terminal of PRKAB1

Aufreinigung: Affinity purified

Immunogen: PRKAB1 antibody was raised using the N terminal of PRKAB1 corresponding to a region with amino acids KILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKAB1 Blocking Peptide, catalog no. 33R-4439, is also available for use as a blocking control in assays to test for specificity of this PRKAB1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKAB1

Target: PRKAB1 (Protein Kinase, AMP-Activated, beta 1 Non-Catalytic Subunit (PRKAB1))

Andere Bezeichnung: PRKAB1 (PRKAB1 Produkte)

Synonyme: AMPK antikoerper, HAMPKb antikoerper, 1300015D22Rik antikoerper, AU021155 antikoerper, E430008F22 antikoerper, MGC82489 antikoerper, prkab1 antikoerper, wu:fk93d05 antikoerper, wu:fw87e09 antikoerper, zgc:56652 antikoerper, zgc:76975 antikoerper, zgc:92228 antikoerper, protein kinase AMP-activated non-catalytic subunit beta 1 antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit S homeolog antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit, b antikoerper, protein kinase, AMP-activated, beta 1 non-catalytic subunit, a antikoerper, PRKAB1 antikoerper, Prkab1 antikoerper, prkab1.S antikoerper, prkab1 antikoerper, prkab1b antikoerper, prkab1a antikoerper

Hintergrund: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha

Molekulargewicht: 30 kDa (MW of target protein)

Pathways: AMPK Signaling, Warburg Effekt