EPS8 Antikörper (Middle Region)

Produktnummer ABIN632256

Produktdetails anti-EPS8 Antikörper

Target: EPS8 (Epidermal Growth Factor Receptor Pathway Substrate 8 (EPS8))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EPS8 antibody was raised against the middle region of EPS8

Aufreinigung: Affinity purified

Immunogen: EPS8 antibody was raised using the middle region of EPS8 corresponding to a region with amino acids VSKVPANITRQNSSSSDSGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPS8 Blocking Peptide, catalog no. 33R-9810, is also available for use as a blocking control in assays to test for specificity of this EPS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPS8

Target: EPS8 (Epidermal Growth Factor Receptor Pathway Substrate 8 (EPS8))

Andere Bezeichnung: EPS8 (EPS8 Produkte)

Synonyme: AW261790 antikoerper, MGC81285 antikoerper, MGC146320 antikoerper, zgc:56041 antikoerper, epidermal growth factor receptor pathway substrate 8 antikoerper, epidermal growth factor receptor pathway substrate 8 L homeolog antikoerper, EPS8 antikoerper, Eps8 antikoerper, eps8.L antikoerper, eps8 antikoerper

Hintergrund: This gene encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Regulation of Actin Filament Polymerization