CSK Antikörper (Middle Region)

Produktnummer ABIN632232

Produktdetails anti-CSK Antikörper

Target: CSK (C-Src tyrosine Kinase (CSK))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CSK antibody was raised against the middle region of CSK

Aufreinigung: Affinity purified

Immunogen: CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSK Blocking Peptide, catalog no. 33R-8387, is also available for use as a blocking control in assays to test for specificity of this CSK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSK

Target: CSK (C-Src tyrosine Kinase (CSK))

Andere Bezeichnung: CSK (CSK Produkte)

Synonyme: AW212630 antikoerper, C-terminal Src kinase antikoerper, c-src tyrosine kinase antikoerper, CSK, non-receptor tyrosine kinase antikoerper, CSK antikoerper, Csk antikoerper

Hintergrund: CSK specifically phosphorylates 'Tyr-504' on LCK, which acts as a negative regulatory site.

Molekulargewicht: 51 kDa (MW of target protein)

Pathways: T-Zell Rezeptor Signalweg, EGFR Signaling Pathway, Cell-Cell Junction Organization, CXCR4-mediated Signaling Events