Fgr Antikörper
-
- Target Alle Fgr (FGR) Antikörper anzeigen
- Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fgr Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
- Top Product
- Discover our top product FGR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FGR Blocking Peptide, catalog no. 33R-1770, is also available for use as a blocking control in assays to test for specificity of this FGR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fgr (FGR) (Gardner-Rasheed Feline Sarcoma Viral (V-Fgr) Oncogene Homolog (FGR))
- Andere Bezeichnung
- FGR (FGR Produkte)
- Synonyme
- SRC2 antikoerper, c-fgr antikoerper, c-src2 antikoerper, p55-Fgr antikoerper, p55c-fgr antikoerper, p58-Fgr antikoerper, p58c-fgr antikoerper, FGR proto-oncogene, Src family tyrosine kinase antikoerper, FGR antikoerper, Fgr antikoerper
- Hintergrund
- This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Stem Cell Maintenance, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, CXCR4-mediated Signaling Events, Thromboxane A2 Receptor Signaling
-