14-3-3 zeta Antikörper (Middle Region)
-
- Target Alle 14-3-3 zeta (YWHAZ) Antikörper anzeigen
- 14-3-3 zeta (YWHAZ)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser 14-3-3 zeta Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- YWHAZ antibody was raised against the middle region of Ywhaz
- Aufreinigung
- Affinity purified
- Immunogen
- YWHAZ antibody was raised using the middle region of Ywhaz corresponding to a region with amino acids FDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN
- Top Product
- Discover our top product YWHAZ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
YWHAZ Blocking Peptide, catalog no. 33R-2862, is also available for use as a blocking control in assays to test for specificity of this YWHAZ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YWHAZ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- 14-3-3 zeta (YWHAZ)
- Andere Bezeichnung
- YWHAZ (YWHAZ Produkte)
- Synonyme
- 14-3-3-zeta antikoerper, KCIP-1 antikoerper, YWHAD antikoerper, 14-3-3zeta antikoerper, Ywhaz antikoerper, ACYPI003154 antikoerper, 14-3-3z antikoerper, kcip-1 antikoerper, ywhaq antikoerper, 1433z antikoerper, ywhaz antikoerper, ywhazb antikoerper, 1110013I11Rik antikoerper, AI596267 antikoerper, AL022924 antikoerper, AU020854 antikoerper, ywhaza antikoerper, fb14h09 antikoerper, wu:fb05g08 antikoerper, wu:fb14h09 antikoerper, ywhai antikoerper, zgc:55807 antikoerper, 14-3-3 antikoerper, 14-3-3 zeta antikoerper, 14-3-3ZETA antikoerper, 14-3-3leo antikoerper, 2G1 antikoerper, 4-3-3 zeta antikoerper, 5.11 antikoerper, 549 antikoerper, BEST:GH05075 antikoerper, CG17870 antikoerper, D14-3-3 antikoerper, D14-3-3zeta antikoerper, Dmel\\CG17870 antikoerper, K antikoerper, LEO antikoerper, Leo antikoerper, PAR-5 antikoerper, PAR5 antikoerper, Par-5 antikoerper, d14-3-3zeta antikoerper, l(2)07103 antikoerper, l(2)46CFe antikoerper, l(2)46Ee antikoerper, leo antikoerper, par-5 antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta antikoerper, 14-3-3 protein zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta L homeolog antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta antikoerper, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta S homeolog antikoerper, 14-3-3 protein zeta/delta pseudogene antikoerper, CG17870 gene product from transcript CG17870-RE antikoerper, YWHAZ antikoerper, 14-3-3zeta antikoerper, ywhaz antikoerper, 1433z antikoerper, ywhaz.L antikoerper, Ywhaz antikoerper, ywhaz.S antikoerper, LOC100855903 antikoerper
- Hintergrund
- YWHAZ belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Apoptose, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Membrane, Production of Molecular Mediator of Immune Response, Maintenance of Protein Location
-