PPM1M Antikörper

Produktnummer ABIN632167

Produktdetails anti-PPM1M Antikörper

Target: PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPM1M Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PPM1 M antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPM1M Blocking Peptide, catalog no. 33R-8149, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPM1M

Target: PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))

Andere Bezeichnung: PPM1M (PPM1M Produkte)

Synonyme: 2810423O19Rik antikoerper, AW610647 antikoerper, C77250 antikoerper, PP2Ceta antikoerper, PP2C-eta antikoerper, PP2CE antikoerper, protein phosphatase 1M antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1M antikoerper, Ppm1m antikoerper, PPM1M antikoerper

Hintergrund: PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.

Molekulargewicht: 27 kDa (MW of target protein)