PPM1M Antikörper (Middle Region)
-
- Target Alle PPM1M Produkte
- PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPM1M Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PPM1 M antibody was raised against the middle region of PPM1
- Aufreinigung
- Affinity purified
- Immunogen
- PPM1 M antibody was raised using the middle region of PPM1 corresponding to a region with amino acids VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPM1M Blocking Peptide, catalog no. 33R-9923, is also available for use as a blocking control in assays to test for specificity of this PPM1M antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1M (Protein Phosphatase 1M (PP2C Domain Containing) (PPM1M))
- Andere Bezeichnung
- PPM1M (PPM1M Produkte)
- Synonyme
- 2810423O19Rik antikoerper, AW610647 antikoerper, C77250 antikoerper, PP2Ceta antikoerper, PP2C-eta antikoerper, PP2CE antikoerper, protein phosphatase 1M antikoerper, protein phosphatase, Mg2+/Mn2+ dependent 1M antikoerper, Ppm1m antikoerper, PPM1M antikoerper
- Hintergrund
- PPM1M belongs to the PP2C family. It contains 1 PP2C-like domain. The exact function of PPM1M is not known.
- Molekulargewicht
- 30 kDa (MW of target protein)
-