ZGPAT Antikörper (C-Term)
-
- Target Alle ZGPAT Antikörper anzeigen
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZGPAT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZGPAT antibody was raised against the C terminal of ZGPAT
- Aufreinigung
- Affinity purified
- Immunogen
- ZGPAT antibody was raised using the C terminal of ZGPAT corresponding to a region with amino acids AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
- Top Product
- Discover our top product ZGPAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZGPAT Blocking Peptide, catalog no. 33R-1217, is also available for use as a blocking control in assays to test for specificity of this ZGPAT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZGPAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZGPAT (Zinc Finger, CCCH-Type with G Patch Domain (ZGPAT))
- Andere Bezeichnung
- ZGPAT (ZGPAT Produkte)
- Synonyme
- zc3h9 antikoerper, gpatc6 antikoerper, gpatch6 antikoerper, zc3hdc9 antikoerper, GPATC6 antikoerper, GPATCH6 antikoerper, KIAA1847 antikoerper, ZC3H9 antikoerper, ZC3HDC9 antikoerper, ZIP antikoerper, 1500006I01Rik antikoerper, BC021513 antikoerper, RGD1310801 antikoerper, zgc:63730 antikoerper, zinc finger CCCH-type and G-patch domain containing antikoerper, zinc finger, CCCH-type with G-patch domain L homeolog antikoerper, zinc finger, CCCH-type with G-patch domain antikoerper, zinc finger, CCCH-type with G patch domain antikoerper, ZGPAT antikoerper, zgpat.L antikoerper, zgpat antikoerper, Zgpat antikoerper
- Hintergrund
- ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway
-