PLEKHH2 Antikörper
-
- Target Alle PLEKHH2 Produkte
- PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLEKHH2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PLEKHH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAIYCQRCVERTQ
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLEKHH2 Blocking Peptide, catalog no. 33R-9995, is also available for use as a blocking control in assays to test for specificity of this PLEKHH2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHH2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLEKHH2 (Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2))
- Andere Bezeichnung
- PLEKHH2 (PLEKHH2 Produkte)
- Synonyme
- RGD1304935 antikoerper, si:ch73-105b23.3 antikoerper, PLEKHH1L antikoerper, AI256725 antikoerper, E030001K05 antikoerper, mKIAA2028 antikoerper, pleckstrin homology, MyTH4 and FERM domain containing H2 antikoerper, pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 antikoerper, Plekhh2 antikoerper, plekhh2 antikoerper, PLEKHH2 antikoerper
- Hintergrund
- PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a single-pass membrane protein. The exact function of PLEKHH2 remains unknown.
- Molekulargewicht
- 168 kDa (MW of target protein)
-