MELK Antikörper (Middle Region)
-
- Target Alle MELK Antikörper anzeigen
- MELK (Maternal Embryonic Leucine Zipper Kinase (MELK))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MELK Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MELK antibody was raised against the middle region of MELK
- Aufreinigung
- Affinity purified
- Immunogen
- MELK antibody was raised using the middle region of MELK corresponding to a region with amino acids AVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIK
- Top Product
- Discover our top product MELK Primärantikörper
-
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 637-651) antibody
MELK Reaktivität: Human ELISA, IHC, ICC, FACS Wirt: Maus Monoclonal 2G2 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) antibodyMELK Reaktivität: Human ELISA, IF, IHC, FACS Wirt: Maus Monoclonal 2G2 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 637-651) antibodyMELK Reaktivität: Human ELISA, IHC, FACS, IF/ICC Wirt: Maus Monoclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 434-468), (C-Term) antibodyMELK Reaktivität: Maus WB, FACS Wirt: Kaninchen Polyclonal RB51204 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) antibodyMELK Reaktivität: Human IF, IHC (p), EIA Wirt: Maus Monoclonal 2G2 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 525-554), (C-Term) antibodyMELK Reaktivität: Human WB Wirt: Kaninchen Polyclonal RB8557 unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (Center) antibodyMELK Reaktivität: Human, Maus, Ratte, Affe WB, IF, IHC, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) antibodyMELK Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 101-250) antibodyMELK Reaktivität: Human ELISA, IF (cc), IF (p), IHC (p), ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Maternal Embryonic Leucine Zipper Kinase (MELK) (AA 381-415) antibodyMELK Reaktivität: Maus WB Wirt: Kaninchen Polyclonal RB51207 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MELK Blocking Peptide, catalog no. 33R-1602, is also available for use as a blocking control in assays to test for specificity of this MELK antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MELK antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MELK (Maternal Embryonic Leucine Zipper Kinase (MELK))
- Andere Bezeichnung
- MELK (MELK Produkte)
- Synonyme
- MELK antikoerper, xmelk antikoerper, Melk antikoerper, HPK38 antikoerper, AI327312 antikoerper, MPK38 antikoerper, mKIAA0175 antikoerper, fb71b01 antikoerper, fe01f04 antikoerper, wu:fb71b01 antikoerper, wu:fe01f04 antikoerper, maternal embryonic leucine zipper kinase antikoerper, maternal embryonic leucine zipper kinase L homeolog antikoerper, MELK antikoerper, melk antikoerper, cgd5_2270 antikoerper, Melk antikoerper, melk.L antikoerper
- Hintergrund
- The protein MELK phosphorylates ZNF622 and may contribute to its redirection to the nucleus. Also it may be involved in the inhibition of spliceosome assembly during mitosis.
- Molekulargewicht
- 75 kDa (MW of target protein)
-
