VPS26B Antikörper

Produktnummer ABIN632013

Produktdetails anti-VPS26B Antikörper

Target: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS26B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: VPS26 B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS26B Blocking Peptide, catalog no. 33R-1235, is also available for use as a blocking control in assays to test for specificity of this VPS26B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS26B

Target: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Andere Bezeichnung: VPS26B (VPS26B Produkte)

Synonyme: VPS26B antikoerper, wu:fb49d07 antikoerper, wu:fb50d06 antikoerper, zgc:56297 antikoerper, pep8b antikoerper, vps26b antikoerper, Pep8b antikoerper, VP26B antikoerper, 1810012I05Rik antikoerper, 2310075A12Rik antikoerper, AI848392 antikoerper, T29A15.180 antikoerper, T29A15_180 antikoerper, vacuolar protein sorting 26B antikoerper, vacuolar protein sorting 26 homolog B (S. pombe) antikoerper, VPS26, retromer complex component B antikoerper, VPS26 retromer complex component B antikoerper, VPS26 retromer complex component B S homeolog antikoerper, vacuolar protein sorting 26B antikoerper, VPS26B antikoerper, vps26b antikoerper, vps26b.S antikoerper, Vps26b antikoerper

Hintergrund: VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process