VPS26B Antikörper

Produktnummer ABIN632013

Der Kaninchen Polyklonal anti-VPS26B Antikörper (ABIN632013) detektiert spezifisch VPS26B in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für VPS26B Antikörper (ABIN632013)

Target: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VPS26B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VPS26B Antikörper

Aufreinigung: Affinity purified

Immunogen: VPS26 B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGYELTPTMRDINKKFSVRYYLNLVLIDEEERRYFKQQEVVLWRKGDIVR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VPS26B Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this VPS26B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VPS26B

Target: VPS26B (Vacuolar Protein Sorting 26 Homolog B (VPS26B))

Andere Bezeichnung: VPS26B

Hintergrund: VPS26B belongs to the VPS26 family. VPS26B is probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process