AP2B1 Antikörper (Middle Region)

Produktnummer ABIN631995

Produktdetails anti-AP2B1 Antikörper

Target: AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AP2B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AP2 B1 antibody was raised against the middle region of AP2 1

Aufreinigung: Affinity purified

Immunogen: AP2 B1 antibody was raised using the middle region of AP2 1 corresponding to a region with amino acids SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AP2B1 Blocking Peptide, catalog no. 33R-8408, is also available for use as a blocking control in assays to test for specificity of this AP2B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AP2B1

Target: AP2B1 (Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1))

Andere Bezeichnung: AP2B1 (AP2B1 Produkte)

Synonyme: 5-HT(2B) antikoerper, 5-HT2B antikoerper, ADTB2 antikoerper, AP105B antikoerper, AP2-BETA antikoerper, CLAPB1 antikoerper, 1300012O03Rik antikoerper, AI788979 antikoerper, fa16e07 antikoerper, wu:fa16c06 antikoerper, wu:fa16e07 antikoerper, wu:fc18c08 antikoerper, zgc:55659 antikoerper, 5-hydroxytryptamine receptor 2B antikoerper, adaptor related protein complex 2 beta 1 subunit antikoerper, adaptor-related protein complex 2, beta 1 subunit antikoerper, adaptor related protein complex 2 beta 1 subunit L homeolog antikoerper, HTR2B antikoerper, AP2B1 antikoerper, Ap2b1 antikoerper, ap2b1 antikoerper, ap2b1.L antikoerper

Hintergrund: AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.

Molekulargewicht: 105 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, EGFR Downregulation